SFRP2

SFRP2
Ідентифікатори
Символи SFRP2, FRP-2, SARP1, SDF-5, secreted frizzled related protein 2
Зовнішні ІД OMIM: 604157 MGI: 108078 HomoloGene: 56438 GeneCards: SFRP2
Онтологія гена
Молекулярна функція

• fibronectin binding
• receptor ligand activity
• endopeptidase activator activity
• integrin binding
• GO:0010577 enzyme activator activity
• G protein-coupled receptor activity
• Wnt-protein binding
• Wnt-activated receptor activity

Клітинна компонента

• GO:0005578 Позаклітинна матриця
• extracellular region
• міжклітинний простір
• integral component of membrane
• collagen-containing extracellular matrix

Біологічний процес

• cellular response to extracellular stimulus
• positive regulation of endopeptidase activity
• Wnt signaling pathway involved in somitogenesis
• somitogenesis
• диференціація клітин
• negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
• male gonad development
• regulation of establishment of planar polarity
• response to nutrient
• collagen fibril organization
• convergent extension involved in axis elongation
• development of primary male sexual characteristics
• positive regulation of canonical Wnt signaling pathway
• negative regulation of mesodermal cell fate specification
• cellular response to X-ray
• cell-cell signaling
• negative regulation of Wnt signaling pathway
• bone morphogenesis
• hematopoietic stem cell proliferation
• chondrocyte development
• embryonic digit morphogenesis
• outflow tract morphogenesis
• cardiac left ventricle morphogenesis
• negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage
• Wnt signaling pathway
• negative regulation of gene expression
• sclerotome development
• positive regulation of peptidyl-serine phosphorylation
• positive regulation of angiogenesis
• planar cell polarity pathway involved in neural tube closure
• negative regulation of BMP signaling pathway
• multicellular organism development
• negative regulation of cardiac muscle cell apoptotic process
• regulation of apoptotic process
• positive regulation of cell growth
• neural tube closure
• negative regulation of peptidyl-tyrosine phosphorylation
• negative regulation of cell migration
• positive regulation of osteoblast differentiation
• regulation of Wnt signaling pathway
• cartilage development
• regulation of cell population proliferation
• regulation of stem cell division
• negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
• negative regulation of cell growth
• neural tube development
• positive regulation of cell population proliferation
• negative regulation of epithelial cell proliferation
• positive regulation of apoptotic process
• branching involved in blood vessel morphogenesis
• post-anal tail morphogenesis
• negative regulation of dermatome development
• negative regulation of planar cell polarity pathway involved in axis elongation
• positive regulation of cell adhesion mediated by integrin
• GO:0045996 negative regulation of transcription, DNA-templated
• negative regulation of JUN kinase activity
• positive regulation of fat cell differentiation
• negative regulation of epithelial to mesenchymal transition
• negative regulation of cell population proliferation
• GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
• digestive tract morphogenesis
• anterior/posterior pattern specification
• GO:0097285 апоптоз
• negative regulation of canonical Wnt signaling pathway
• regulation of midbrain dopaminergic neuron differentiation
• regulation of neuron projection development
• G protein-coupled receptor signaling pathway
• non-canonical Wnt signaling pathway
• regulation of signaling receptor activity
• canonical Wnt signaling pathway

Джерела:Amigo / QuickGO
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
6423
20319
Ensembl
ENSG00000145423
ENSMUSG00000027996
UniProt
Q96HF1
P97299
RefSeq (мРНК)
NM_003013
NM_009144
RefSeq (білок)
NP_003004
NP_033170
Локус (UCSC) Хр. 4: 153.78 – 153.79 Mb Хр. 3: 83.67 – 83.68 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SFRP2 (англ. Secreted frizzled related protein 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 295 амінокислот, а молекулярна маса — 33 490[4].

Послідовність амінокислот
1020304050
MLQGPGSLLLLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLC
HGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFA
PVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDND
LCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKV
KEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEM
NDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC

Кодований геном білок за функцією належить до білків розвитку. Задіяний у таких біологічних процесах як диференціація, сигнальний шлях Wnt, поліморфізм. Секретований назовні.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 13: 2819—2824. PMID 15340161 DOI:10.1110/ps.04682504

Примітки

  1. ↑ Human PubMed Reference:.
  2. ↑ Mouse PubMed Reference:.
  3. ↑ HUGO Gene Nomenclature Commitee, HGNC:10777 (англ.) . Архів оригіналу за 11 вересня 2015. Процитовано 30 серпня 2017.
  4. ↑ UniProt, Q96HF1 (англ.) . Архів оригіналу за 8 серпня 2017. Процитовано 30 серпня 2017.

Див. також

  • Хромосома 4
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»

На цю статтю не посилаються інші статті Вікіпедії.
Будь ласка розставте посилання відповідно до прийнятих рекомендацій.