FGF10

FGF10
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

1NUN

Ідентифікатори
Символи FGF10, fibroblast growth factor 10
Зовнішні ІД OMIM: 602115 MGI: 1099809 HomoloGene: 3284 GeneCards: FGF10
Пов'язані генетичні захворювання
рак простати, LADD syndrome[1]
Онтологія гена
Молекулярна функція

heparin binding
type 2 fibroblast growth factor receptor binding
growth factor activity
GO:0001948, GO:0016582 protein binding
fibroblast growth factor receptor binding
chemoattractant activity
protein tyrosine kinase activity
1-phosphatidylinositol-3-kinase activity
phosphatidylinositol-4,5-bisphosphate 3-kinase activity

Клітинна компонента

extracellular region
клітинне ядро
cell surface
GO:0005578 Позаклітинна матриця
клітинна мембрана
міжклітинний простір
collagen-containing extracellular matrix

Біологічний процес

bud outgrowth involved in lung branching
limb bud formation
organ growth
semicircular canal morphogenesis
embryonic pattern specification
bud elongation involved in lung branching
positive regulation of canonical Wnt signaling pathway
muscle cell fate commitment
сльозовиділення
positive regulation of Ras protein signal transduction
positive regulation of urothelial cell proliferation
regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling
limb development
radial glial cell differentiation
female genitalia morphogenesis
mesonephros development
odontogenesis of dentin-containing tooth
prostatic bud formation
blood vessel remodeling
regulation of saliva secretion
Ангіогенез
establishment of mitotic spindle orientation
positive regulation of ERK1 and ERK2 cascade
embryonic digestive tract morphogenesis
animal organ morphogenesis
hair follicle morphogenesis
metanephros development
lung saccule development
lung epithelium development
positive regulation of Notch signaling pathway
negative regulation of cell population proliferation
branch elongation involved in salivary gland morphogenesis
branching involved in salivary gland morphogenesis
positive regulation of white fat cell proliferation
bronchiole morphogenesis
limb morphogenesis
blood vessel morphogenesis
lung development
thymus development
positive regulation of fibroblast proliferation
negative regulation of cell differentiation
ERK1 and ERK2 cascade
positive regulation of epithelial cell migration
positive regulation of mitotic cell cycle
spleen development
smooth muscle cell differentiation
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
positive regulation of Wnt signaling pathway
Harderian gland development
protein localization to cell surface
respiratory system development
epidermis development
positive regulation of peptidyl-tyrosine phosphorylation
metanephros morphogenesis
pancreas development
mammary gland bud formation
positive chemotaxis
mesenchymal-epithelial cell signaling involved in lung development
positive regulation of hair follicle cell proliferation
lacrimal gland development
positive regulation of MAPK cascade
диференціація клітин
positive regulation of keratinocyte proliferation
positive regulation of ATP-dependent activity
positive regulation of epithelial cell proliferation involved in wound healing
epithelial cell differentiation
organ induction
positive regulation of epithelial cell proliferation
epidermis morphogenesis
Загоєння ран
epithelial cell proliferation
regulation of activin receptor signaling pathway
positive regulation of DNA replication
хемотаксис
embryonic genitalia morphogenesis
salivary gland development
positive regulation of keratinocyte migration
response to lipopolysaccharide
thyroid gland development
keratinocyte proliferation
semicircular canal fusion
mammary gland specification
epithelial cell migration
white fat cell differentiation
регуляція експресії генів
lung alveolus development
branching morphogenesis of an epithelial tube
embryonic digestive tract development
lung proximal/distal axis specification
fibroblast growth factor receptor signaling pathway involved in mammary gland specification
actin cytoskeleton reorganization
positive regulation of vascular endothelial growth factor receptor signaling pathway
pituitary gland development
response to estradiol
secretion by lung epithelial cell involved in lung growth
mesenchymal cell differentiation involved in lung development
lung morphogenesis
GO:1904578 response to organic cyclic compound
somatic stem cell population maintenance
tissue regeneration
otic vesicle formation
epithelial cell proliferation involved in salivary gland morphogenesis
cell-cell signaling
male genitalia morphogenesis
GO:1900404 positive regulation of DNA repair
salivary gland morphogenesis
MAPK cascade
embryonic camera-type eye development
induction of positive chemotaxis
urothelial cell proliferation
animal organ formation
fibroblast growth factor receptor signaling pathway
regulation of smoothened signaling pathway
determination of left/right symmetry
inner ear morphogenesis
positive regulation of cell population proliferation
submandibular salivary gland formation
type II pneumocyte differentiation
negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
digestive tract development
regulation of epithelial cell proliferation
epithelial tube branching involved in lung morphogenesis
positive regulation of lymphocyte proliferation
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
phosphatidylinositol phosphate biosynthetic process
phosphatidylinositol-3-phosphate biosynthetic process
peptidyl-tyrosine phosphorylation
regulation of signaling receptor activity
positive regulation of protein kinase B signaling
positive regulation of G1/S transition of mitotic cell cycle

Джерела:Amigo / QuickGO
Ортологи
Види Людина Миша
Entrez
2255
14165
Ensembl
ENSG00000070193
ENSMUSG00000021732
UniProt
O15520
O35565
RefSeq (мРНК)
NM_004465
NM_008002
RefSeq (білок)
NP_004456
NP_032028
Локус (UCSC) Хр. 5: 44.3 – 44.39 Mb Хр. 13: 118.81 – 118.93 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

FGF10 (англ. Fibroblast growth factor 10) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 208 амінокислот, а молекулярна маса — 23 436[5].

Послідовність амінокислот
1020304050
MWKWILTHCASAFPHLPGCCCCCFLLLFLVSSVPVTCQALGQDMVSPEAT
NSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSG
TKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDC
KLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAH
FLPMVVHS

Кодований геном білок за функцією належить до факторів росту. Секретований назовні.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Turner N., Grose R. (2010). Fibroblast growth factor signalling: from development to cancer. Nat. Rev. Cancer. 10: 116—129. PMID 20094046 DOI:10.1038/nrc2780
  • Milunsky J.M., Zhao G., Maher T.A., Colby R., Everman D.B. (2006). LADD syndrome is caused by FGF10 mutations. Clin. Genet. 69: 349—354. PMID 16630169 DOI:10.1111/j.1399-0004.2006.00597.x

Примітки

  1. Захворювання, генетично пов'язані з FGF10 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:3666 (англ.) . Процитовано 31 серпня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  5. UniProt, O15520 (англ.) . Архів оригіналу за 6 жовтня 2017. Процитовано 31 серпня 2017.

Див. також

  • Хромосома 5
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»

На цю статтю не посилаються інші статті Вікіпедії.
Будь ласка розставте посилання відповідно до прийнятих рекомендацій.